PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA06G0003400.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB_related
Protein Properties Length: 300aa    MW: 33261.6 Da    PI: 7.4761
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA06G0003400.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.31.5e-124286147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                       r +WT  E++++++a +++  + Wk+I +++g  +t  q++s+ qky
  ORGLA06G0003400.1 42 RESWTDPEHDKFLEALQLFDRD-WKKIEAYVG-SKTVIQIRSHAQKY 86
                       789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.92E-163692IPR009057Homeodomain-like
PROSITE profilePS5129414.2343791IPR017930Myb domain
TIGRFAMsTIGR015571.9E-184089IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.609.0E-64092IPR009057Homeodomain-like
SMARTSM007177.1E-104189IPR001005SANT/Myb domain
PfamPF002493.8E-104286IPR001005SANT/Myb domain
CDDcd001671.77E-74487No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MSSAPQQLLD SSSPGPGPGP GPEVEDDGGR RVRKPYTITK SRESWTDPEH DKFLEALQLF  60
DRDWKKIEAY VGSKTVIQIR SHAQKYFLKV QKNGTGEHLP PPRPKRKAAH PYPHKASKRA  120
PQVVLPQQAS HLMEQGCLIP MDISPVARNF NANDVFSSWD SALAQSFSPR HTHGAANNCS  180
SSVESQSGTC PTSEAIEQEI MLPTLRAMPD FAQVYNFLGS IFDPETSGHL QRLREMDPID  240
VETVLLLMKN LSINLTNPNF EAHRKVLASH GSGMDQVKHE SLGDLGSTHT LHLPFMVTTK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1116720.0AK111672.1 Oryza sativa Japonica Group cDNA clone:J013156D15, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015642931.10.0PREDICTED: protein REVEILLE 6
SwissprotQ8RWU34e-94RVE8_ARATH; Protein REVEILLE 8
TrEMBLI1PYS20.0I1PYS2_ORYGL; Uncharacterized protein
STRINGORGLA06G0003400.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP109638111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52660.24e-79MYB_related family protein